PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0013s0230.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family ARF
Protein Properties Length: 692aa    MW: 76657.7 Da    PI: 6.8349
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0013s0230.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3727.6e-23116216198
                             EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEE CS
                      B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvF 82 
                             f+k+lt sd++++g +++ +k+a+e+     +++ + +++l  +d++g  W++k+i+r++++r++lt+GW+ Fv +++L +gD++vF
  SapurV1A.0013s0230.1.p 116 FCKILTASDTSTHGGFSVLRKHATEClppldMSQATPTQELAARDLHGYDWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDSFVF 202
                             99****************************9555566679*********************************************** PP

                             EE-SSSEE..EEEEE- CS
                      B3  83 kldgrsefelvvkvfr 98 
                                + +++el+v+++r
  SapurV1A.0013s0230.1.p 203 L--RGDNGELRVGLRR 216
                             *..3489999**9997 PP

2Auxin_resp94.22.1e-31242321183
              Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                             a+ha+ t+s F v+Y+Pr+   ++++ ++k+++a+k+ +svGmRfkm+fe+eds+err++Gt+vgv d++p +W++S WrsLk
  SapurV1A.0013s0230.1.p 242 ASHAVLTQSLFLVYYKPRT--NQYIIGLNKYLEAVKNGFSVGMRFKMRFEGEDSPERRFTGTIVGVGDFSP-EWSGSIWRSLK 321
                             68999*************6..99************************************************.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.57E-40107245IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.8E-39109231IPR015300DNA-binding pseudobarrel domain
CDDcd100171.37E-18114216No hitNo description
SMARTSM010193.3E-21116218IPR003340B3 DNA binding domain
PROSITE profilePS5086311.885116218IPR003340B3 DNA binding domain
PfamPF023625.0E-21116216IPR003340B3 DNA binding domain
PfamPF065072.2E-29242321IPR010525Auxin response factor
PfamPF023092.2E-11551663IPR033389AUX/IAA domain
SuperFamilySSF542776.47E-11570651No hitNo description
PROSITE profilePS5174524.801576656IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 692 aa     Download sequence    Send to blast
MAQTERAGDD LYTELWKACA GPLVDVPKAG ERVFYFPQGH MEQLEASTTQ ELNQQIPRFN  60
LPSKILCRVI NIQLLAEQDT DEVYAQITLQ PEADQTKPTS PEPCPPEPAK QTVHSFCKIL  120
TASDTSTHGG FSVLRKHATE CLPPLDMSQA TPTQELAARD LHGYDWRFKH IFRGQPRRHL  180
LTTGWSTFVT SKRLVAGDSF VFLRGDNGEL RVGLRRLARQ QSSIPSSVIS SQSMHLGVLA  240
TASHAVLTQS LFLVYYKPRT NQYIIGLNKY LEAVKNGFSV GMRFKMRFEG EDSPERRFTG  300
TIVGVGDFSP EWSGSIWRSL KIQWDEPATI QRPERVSPWD IEPFAAPSSP NLTQQVVKSK  360
RPRPVDIPAS EITANPAASA FWYHGPTQSR ELVQRGSIIE AQSSESHIWS MRQKEVDSSL  420
NNSGGCNSRA RPEGIWLPSS HMNVSLNFFP DPAGDNKCAK TQSIISGFAS SISSMQSDGL  480
INEQVEKGRK FENSVGCRLF GIDLTSNSGI TAAPEKEPAY PIVDYNEAKG LFPAAGEAEK  540
AQTMEFSMSS KQQKQVVPDA LAKESQSKQG STTSTRTRTK VQMQGVAVGR ALDLTVLKGY  600
KDLIIELGKM FEIGELSTRE KWTVVFTDDE GDMMLVGDDP WPEFCKMVKK IYIYSSEEVK  660
KMSARCKLPA SSFEGEGTAV SMESEHKSDA A*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldx_B1e-173934417355Auxin response factor 1
4ldx_A1e-173934417355Auxin response factor 1
4ldw_B1e-173934417355Auxin response factor 1
4ldw_A1e-173934417355Auxin response factor 1
4ldv_A1e-173934417355Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1359363KRPRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT1646980.0KT164698.1 Populus tomentosa clone Potom.002G07206 auxin response factor 11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006375372.10.0hypothetical protein POPTR_0014s09560g
SwissprotQ9C5W90.0ARFR_ARATH; Auxin response factor 18
TrEMBLU5FSL20.0U5FSL2_POPTR; Auxin response factor
STRINGPOPTR_0014s09560.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15113396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.20.0auxin response factor 9